PDB entry 2qjn

View 2qjn on RCSB PDB site
Description: Crystal structure of D-mannonate dehydratase from Novosphingobium aromaticivorans complexed with Mg and 2-keto-3-deoxy-D-gluconate
Class: lyase
Keywords: D-mannonate dehydratase, enolase superfamily, LYASE
Deposited on 2007-07-08, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qjna1, d2qjna2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qjnb1, d2qjnb2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qjnc1, d2qjnc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qjnd1, d2qjnd2
  • Heterogens: MG, KDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qjnA (A:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjnA (A:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgiaslpsvtgwdtrkalnyvpklfeel
    rktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrlvrqhtvtp
    lavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvrtgchgatdl
    spvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpghgvdidee
    laakypykpaylpvarledgtmwnw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qjnB (B:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjnB (B:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgiaslpsvtgwdtrkalnyvpklfeel
    rktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrlvrqhtvtp
    lavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvrtgchgatdl
    spvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpghgvdidee
    laakypykpaylpvarledgtmwnw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qjnC (C:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjnC (C:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgislpsvtgwdtrkalnyvpklfeelr
    ktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrlvrqhtvtpl
    avgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvrtgchgatdls
    pvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpghgvdideel
    aakypykpaylpvarledgtmwnw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qjnD (D:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjnD (D:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgiaslpsvtgwdtrkalnyvpklfeel
    rktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrlvrqhtvtp
    lavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvrtgchgatdl
    spvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpghgvdidee
    laakypykpaylpvarledgtmwnw