PDB entry 2qjl

View 2qjl on RCSB PDB site
Description: Crystal structure of Urm1
Class: signaling protein
Keywords: Ubiquitin-like protein, SIGNALING PROTEIN
Deposited on 2007-07-07, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.168
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-related modifier 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Urm1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qjla_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qjlA (A:)
    mvnvkveflggldaifgkqrvhkikmdkedpvtvgdlidhivstminnpndvsifiedds
    irpgiitlindtdwelegekdyiledgdiisftstlhgg