PDB entry 2qji

View 2qji on RCSB PDB site
Description: M. jannaschii ADH synthase complexed with dihydroxyacetone phosphate and glycerol
Class: lyase
Keywords: beta-alpha barrel, LYASE
Deposited on 2007-07-07, released 2007-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjia_
  • Chain 'B':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjib_
  • Chain 'C':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjic_
  • Chain 'D':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjid_
  • Chain 'E':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjie_
  • Chain 'F':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjif_
  • Chain 'G':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjig_
  • Chain 'H':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjih_
  • Chain 'I':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjii_
  • Chain 'J':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjij_
  • Chain 'K':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjik_
  • Chain 'L':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjil_
  • Chain 'M':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjim_
  • Chain 'N':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjin_
  • Chain 'O':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjio_
  • Chain 'P':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjip_
  • Chain 'Q':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjiq_
  • Chain 'R':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjir_
  • Chain 'S':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjis_
  • Chain 'T':
    Compound: Putative aldolase MJ0400
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qjit_
  • Heterogens: 13P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qjiA (A:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiA (A:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qjiB (B:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiB (B:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qjiC (C:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiC (C:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qjiD (D:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiD (D:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qjiE (E:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiE (E:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qjiF (F:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiF (F:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2qjiG (G:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiG (G:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2qjiH (H:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiH (H:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2qjiI (I:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiI (I:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2qjiJ (J:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiJ (J:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2qjiK (K:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiK (K:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2qjiL (L:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiL (L:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2qjiM (M:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiM (M:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2qjiN (N:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiN (N:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2qjiO (O:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiO (O:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2qjiP (P:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiP (P:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2qjiQ (Q:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiQ (Q:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2qjiR (R:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiR (R:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2qjiS (S:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiS (S:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrnif
    qhddvvgitravckivhenadveealkeirk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2qjiT (T:)
    melfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggan
    avllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihv
    nvgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelga
    divktsytgdidsfrdvvkgcpapvvvaggpktntdeeflqmikdameagaagvavgrni
    fqhddvvgitravckivhenadveealkeirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjiT (T:)
    elfkdiknlgklvrlerifnresektvivpmdhgvsngpikglidirktvndvaeggana
    vllhkgivrhghrgygkdvgliihlsggtaispnplkkvivttveeairmgadavsihvn
    vgsdedweayrdlgmiaetceywgmpliammyprgkhiqnerdpelvahaarlgaelgad
    ivktsytgdidsfrdvvkgcpapvvvaggpktdeeflqmikdameagaagvavgrnifqh
    ddvvgitravckivhenadveealkeirk