PDB entry 2qiv

View 2qiv on RCSB PDB site
Description: Structural basis for the acyl chain selectivity and mechanism of UDP-N-acetylglucosamine acyltransferase
Class: transferase
Keywords: left-handed parallel beta helix; protein lipid recognition, transferase
Deposited on 2007-07-05, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: UDP-N-acetylglucosamine acyltransferase
    Species: Escherichia coli [TaxId:83333]
    Gene: lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qivx_
  • Heterogens: U21, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qivX (X:)
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir