PDB entry 2qin

View 2qin on RCSB PDB site
Description: Stenotrophomonas maltophilia L1 Metallo-beta-Lactamase Asp-120 Cys mutant
Class: hydrolase
Keywords: metallo-beta-lactamase, hydrolase, binuclear, dinuclear
Deposited on 2007-07-05, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.175
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52700
      • engineered (87)
    Domains in SCOPe 2.06: d2qina_
  • Chain 'B':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52700
      • engineered (87)
    Domains in SCOPe 2.06: d2qinb_
  • Chain 'C':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52700
      • engineered (87)
    Domains in SCOPe 2.06: d2qinc_
  • Chain 'D':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52700
      • engineered (87)
    Domains in SCOPe 2.06: d2qind_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qinA (A:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qinA (A:)
    vplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmash
    lldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsddl
    hfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvriay
    adslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaragak
    altckayadaaeqkfdgqlaket
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qinB (B:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qinB (B:)
    plpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmashl
    ldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsddlh
    fgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvriaya
    dslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaragaka
    ltckayadaaeqkfdgqlaketag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qinC (C:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qinC (C:)
    vplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmash
    lldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsddl
    hfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvriay
    adslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaragak
    altckayadaaeqkfdgqlaketag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qinD (D:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qinD (D:)
    vplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmash
    lldnmkargvtprdlrlillshahachagpvaelkrrtgakvaanaesavllarggsddl
    hfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvriay
    adslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaragak
    altckayadaaeqkfdgqlaketag