PDB entry 2qic

View 2qic on RCSB PDB site
Description: Crystal Structure of the ING1 PHD Finger in complex with a Histone H3K4ME3 peptide
Class: antitumor protein, apoptosis
Keywords: phd, ing1, histone, h3k4me3, chromatin, antitumor protein, apoptosis
Deposited on 2007-07-03, released 2008-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.24
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of growth protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ING1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qica_
  • Chain 'B':
    Compound: H3K4Me3 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2QIC (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2qicA (A:)
gsdlpidpneptyclcnqvsygemigcdndecpiewfhfscvglnhkpkgkwycpkcrge
ne

    Sequence, based on observed residues (ATOM records): (download) 
    >2qicA (A:)
eptyclcnqvsygemigcdndecpiewfhfscvglnhkpkgkwycpkcrge

  • Chain 'B':
    No sequence available.