PDB entry 2qi9

View 2qi9 on RCSB PDB site
Description: ABC-transporter BtuCD in complex with its periplasmic binding protein BtuF
Class: membrane protein
Keywords: Inner membrane, Membrane, Transmembrane, Transport, ATP-binding, Hydrolase, Nucleotide-binding, Periplasm, MEMBRANE PROTEIN
Deposited on 2007-07-03, released 2007-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.262
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12 import system permease protein btuC
    Species: Escherichia coli [TaxId:562]
    Gene: BTUC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06609 (0-End)
      • engineered (17)
      • engineered (31)
      • engineered (119)
      • engineered (155)
      • engineered (204-205)
      • engineered (266)
    Domains in SCOPe 2.05: d2qi9a_
  • Chain 'B':
    Compound: Vitamin B12 import system permease protein btuC
    Species: Escherichia coli [TaxId:562]
    Gene: BTUC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06609 (0-End)
      • engineered (17)
      • engineered (31)
      • engineered (119)
      • engineered (155)
      • engineered (204-205)
      • engineered (266)
    Domains in SCOPe 2.05: d2qi9b_
  • Chain 'C':
    Compound: Vitamin B12 import ATP-binding protein btuD
    Species: Escherichia coli [TaxId:562]
    Gene: BTUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06611 (Start-248)
      • engineered (179)
    Domains in SCOPe 2.05: d2qi9c_
  • Chain 'D':
    Compound: Vitamin B12 import ATP-binding protein btuD
    Species: Escherichia coli [TaxId:562]
    Gene: BTUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06611 (Start-248)
      • engineered (179)
    Domains in SCOPe 2.05: d2qi9d_
  • Chain 'F':
    Compound: Vitamin B12-binding protein btuF
    Species: Escherichia coli [TaxId:562]
    Gene: btuf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qi9f_
  • Heterogens: PO4, SO4, 1PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qi9A (A:)
    mltlarqqqrqnirwllslsvlmllalllslsageqwispgdwftprgelfvwqirlprt
    lavllvgaalaisgavmqalfenplaepgllgvsngagvgliaavllgqgqlpnwalgls
    aiagaliitlillrfarrhlstsrlllagvalgiissalmtwaiyfstsvdlrqlmywmm
    ggfggvdwrqswlmlalipvllwissqsrpmnmlalgeisarqlglplwfwrnvlvaatg
    wmvgvsvalagaigfiglviphilrlsgltdhrvllpgcalagasallladivarlalaa
    aelpigvvtatlgapvfiwlllkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qi9A (A:)
    mltlarqqqrqnirwllslsvlmllalllslsageqwispgdwftprgelfvwqirlprt
    lavllvgaalaisgavmqalfenplaepgllgvsngagvgliaavllgqgqlpnwalgls
    aiagaliitlillrfarrhlstsrlllagvalgiissalmtwaiyfstsvdlrqlmywmm
    ggfggvdwrqswlmlalipvllwissqsrpmnmlalgeisarqlglplwfwrnvlvaatg
    wmvgvsvalagaigfiglviphilrlsgltdhrvllpgcalagasallladivarlalaa
    aelpigvvtatlgapvfiwlllka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qi9B (B:)
    mltlarqqqrqnirwllslsvlmllalllslsageqwispgdwftprgelfvwqirlprt
    lavllvgaalaisgavmqalfenplaepgllgvsngagvgliaavllgqgqlpnwalgls
    aiagaliitlillrfarrhlstsrlllagvalgiissalmtwaiyfstsvdlrqlmywmm
    ggfggvdwrqswlmlalipvllwissqsrpmnmlalgeisarqlglplwfwrnvlvaatg
    wmvgvsvalagaigfiglviphilrlsgltdhrvllpgcalagasallladivarlalaa
    aelpigvvtatlgapvfiwlllkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qi9B (B:)
    mltlarqqqrqnirwllslsvlmllalllslsageqwispgdwftprgelfvwqirlprt
    lavllvgaalaisgavmqalfenplaepgllgvsngagvgliaavllgqgqlpnwalgls
    aiagaliitlillrfarrhlstsrlllagvalgiissalmtwaiyfstsvdlrqlmywmm
    ggfggvdwrqswlmlalipvllwissqsrpmnmlalgeisarqlglplwfwrnvlvaatg
    wmvgvsvalagaigfiglviphilrlsgltdhrvllpgcalagasallladivarlalaa
    aelpigvvtatlgapvfiwlllka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qi9C (C:)
    msivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfag
    qpleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddkl
    grstnqlsggewqrvrlaavvlqitpqanpagqlllldepmnsldvaqqsaldkilsals
    qqglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldie
    ghrmlisti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qi9C (C:)
    sivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfagq
    pleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddklg
    rstnqlsggewqrvrlaavvlqitpqanpagqlllldepmnsldvaqqsaldkilsalsq
    qglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldieg
    hrmlisti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qi9D (D:)
    msivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfag
    qpleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddkl
    grstnqlsggewqrvrlaavvlqitpqanpagqlllldepmnsldvaqqsaldkilsals
    qqglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldie
    ghrmlisti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qi9D (D:)
    sivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfagq
    pleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddklg
    rstnqlsggewqrvrlaavvlqitpqanpagqlllldepmnsldvaqqsaldkilsalsq
    qglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldieg
    hrmlisti
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qi9F (F:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd