PDB entry 2qi7
View 2qi7 on RCSB PDB site
Description: Crystal structure of protease inhibitor, MIT-2-AD86 in complex with wild type HIV-1 protease
Class: hydrolase
Keywords: Drug design, HIV-1 protease, protease inhibitors, HYDROLASE
Deposited on
2007-07-03, released
2008-04-22
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2qi7a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2qi7b_ - Heterogens: PO4, ACT, MZ9, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2qi7A (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2qi7B (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf