PDB entry 2qi4

View 2qi4 on RCSB PDB site
Description: Crystal structure of protease inhibitor, MIT-2-AD93 in complex with wild type HIV-1 protease
Class: hydrolase
Keywords: Drug design, HIV-1 protease, protease inhibitors, HYDROLASE
Deposited on 2007-07-03, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38732 (0-98)
      • engineered (6)
    Domains in SCOPe 2.08: d2qi4a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38732 (0-98)
      • engineered (6)
    Domains in SCOPe 2.08: d2qi4b_
  • Heterogens: PO4, MZ6, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qi4A (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qi4B (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf