PDB entry 2qhx

View 2qhx on RCSB PDB site
Description: Structure of Pteridine Reductase from Leishmania major complexed with a ligand
Class: oxidoreductase
Keywords: oxidoreductase, short-chain dehydrogenase/reductase, pteridine reductase, trypanosomatid, pterin salvage, drug resistance, methotrexate resistance, enzyme inhibitor, NADP/NADPH
Deposited on 2007-07-03, released 2007-12-25
The last revision prior to the SCOP 1.75 freeze date was dated 2009-01-06, with a file datestamp of 2009-01-02.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Gene: PTR1, HMTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01782 (Start-327)
      • see remark 999 (201)
    Domains in SCOP 1.75: d2qhxa1
  • Chain 'B':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Gene: PTR1, HMTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01782 (Start-327)
      • see remark 999 (201)
    Domains in SCOP 1.75: d2qhxb1
  • Chain 'C':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Gene: PTR1, HMTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01782 (Start-327)
      • see remark 999 (201)
    Domains in SCOP 1.75: d2qhxc1
  • Chain 'D':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Gene: PTR1, HMTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01782 (Start-327)
      • see remark 999 (201)
    Domains in SCOP 1.75: d2qhxd1
  • Heterogens: IOD, NAP, FE1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qhxA (A:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmtaptvpvalvtgaakrlgr
    siaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqadlsnvatapvsgadgs
    apvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedghepcvgdreametat
    adlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakga
    legltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdv
    viflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qhxA (A:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllreametatadlf
    gsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegl
    trsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvifl
    csskakyitgtcvkvdggysltra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qhxB (B:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmtaptvpvalvtgaakrlgr
    siaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqadlsnvatapvsgadgs
    apvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedghepcvgdreametat
    adlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakga
    legltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdv
    viflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qhxB (B:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllreametatadl
    fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
    ltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvif
    lcsskakyitgtcvkvdggysltra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qhxC (C:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmtaptvpvalvtgaakrlgr
    siaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqadlsnvatapvsgadgs
    apvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedghepcvgdreametat
    adlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakga
    legltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdv
    viflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qhxC (C:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrametatadlfgs
    naiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegltr
    saalelaplqirvngvgpglsvlveghrskvplyqrdssaaevsdvviflcsskakyitg
    tcvkvdggysltra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qhxD (D:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmtaptvpvalvtgaakrlgr
    siaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqadlsnvatapvsgadgs
    apvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedghepcvgdreametat
    adlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakga
    legltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdv
    viflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qhxD (D:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrdreametatad
    lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
    gltrsaalelaplqirvngvgpglsvlveghrskvplyqrdssaaevsdvviflcsskak
    yitgtcvkvdggysltra