PDB entry 2qhm

View 2qhm on RCSB PDB site
Description: crystal structure of Chek1 in complex with inhibitor 2a
Class: transferase
Keywords: Chek1, Kinase, cell cycle checkpoint, TRANSFERASE
Deposited on 2007-07-02, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qhma_
  • Heterogens: 7CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qhmA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgfskhiqsnldf
    spvnsasrtpgsgwskehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qhmA (A:)
    avpfvedwdlvqtlggevqlavnrvteeavavkivdmknikkeicinkmlnhenvvkfyg
    hrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdik
    penlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvw
    scgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsa
    ritipdikkdrwynkplkkgakrprvts