PDB entry 2qhd

View 2qhd on RCSB PDB site
Description: Crystal structure of ecarpholin S (ser49-PLA2) complexed with fatty acid
Class: hydrolase
Keywords: beta sheet, three helices, protein-ligand complex, hydrolase
Deposited on 2007-07-02, released 2007-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Echis carinatus [TaxId:40353]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qhda_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Echis carinatus [TaxId:40353]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qhdb_
  • Heterogens: DAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qhdA (A:)
    svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
    tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
    kc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qhdB (B:)
    svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
    tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
    kc