PDB entry 2qhc
View 2qhc on RCSB PDB site
Description: The Influence of I47A Mutation on Reduced Susceptibility to the Protease Inhibitor Lopinavir
Class: hydrolase
Keywords: HIV protease inhibitors; protease-inhibitor structure; Aspartic Protease, Resistant Strain, HYDROLASE
Deposited on
2007-07-02, released
2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-06-09, with a file datestamp of
2009-06-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2qhca_ - Chain 'B':
Compound: protease retropepsin
Species: human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2qhcb_ - Heterogens: BME, AB1, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2qhcA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2qhcB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf