PDB entry 2qhc

View 2qhc on RCSB PDB site
Description: The Influence of I47A Mutation on Reduced Susceptibility to the Protease Inhibitor Lopinavir
Class: hydrolase
Keywords: HIV protease inhibitors; protease-inhibitor structure; Aspartic Protease, Resistant Strain, HYDROLASE
Deposited on 2007-07-02, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (46)
    Domains in SCOPe 2.08: d2qhca_
  • Chain 'B':
    Compound: protease retropepsin
    Species: human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (46)
    Domains in SCOPe 2.08: d2qhcb_
  • Heterogens: BME, AB1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qhcA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qhcB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf