PDB entry 2qh6

View 2qh6 on RCSB PDB site
Description: Crystal Structure of the Estrogen Receptor Alpha Ligand Binding Domain Complexed with an Oxabicyclic diarylethylene Compound
Class: transcription
Keywords: Protein-Ligand Complex, TRANSCRIPTION
Deposited on 2007-06-29, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (240)
    Domains in SCOPe 2.07: d2qh6a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (240)
    Domains in SCOPe 2.07: d2qh6b_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ODE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qh6A (A:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    sdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qh6A (A:)
    nslalsltadqmvsalldaeppilyseydrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytfkdhihrvldkitdtlihlmakagl
    tlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvplsdlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qh6B (B:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    sdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qh6B (B:)
    slalsltadqmvsalldaeppilyseydfseasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytfdhihrvldkitdtlihlmakagltlqq
    qhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldah
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.