PDB entry 2qgx

View 2qgx on RCSB PDB site
Description: Ubiquitin-conjugating enzyme E2Q
Class: ligase
Keywords: ubiquitin conjugating protein, UBC, Structural Genomics, Structural Genomics Consortium, SGC, ligase
Deposited on 2007-06-29, released 2008-03-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.168
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 Q1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2Q1, NICE5, UBE2Q
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qgxa_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 Q1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2Q1, NICE5, UBE2Q
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qgxb_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 Q1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2Q1, NICE5, UBE2Q
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qgxc_
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 Q1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2Q1, NICE5, UBE2Q
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qgxd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qgxA (A:)
    gsgsvqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqi
    lkekegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssays
    iesvimqisatlvkgkarvqfganksqysltraqqsykslvqihekngw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgxA (A:)
    svqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdsalhndlqilkeke
    gadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssaysiesvi
    mqisatlvkgkarvqfganksqysltraqqsykslv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qgxB (B:)
    gsgsvqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqi
    lkekegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssays
    iesvimqisatlvkgkarvqfganksqysltraqqsykslvqihekngw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgxB (B:)
    gsvqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqilk
    ekegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssaysie
    svimqisatlvkgkarvqfganksqysltraqqsykslvqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qgxC (C:)
    gsgsvqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqi
    lkekegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssays
    iesvimqisatlvkgkarvqfganksqysltraqqsykslvqihekngw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgxC (C:)
    svqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqilke
    kegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssaysies
    vimqisatlvkgkarvqfganksqysltraqqsykslvqih
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qgxD (D:)
    gsgsvqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqi
    lkekegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssays
    iesvimqisatlvkgkarvqfganksqysltraqqsykslvqihekngw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgxD (D:)
    gsvqatdrlmkelrdiyrsqsfkggnyavelvndslydwnvkllkvdqdsalhndlqilk
    ekegadfillnfsfkdnfpfdppfvrvvspvlsggyvlgggaicmelltkqgwssaysie
    svimqisatlvkgkarvqfganksqysltraqqsykslvq