PDB entry 2qgv

View 2qgv on RCSB PDB site
Description: Crystal structure of hydrogenase-1 operon protein hyaE from Shigella flexneri. Northeast Structural Genomics Consortium Target SfR170
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-06-29, released 2007-07-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.253
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgva_
  • Chain 'B':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvb_
  • Chain 'C':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvc_
  • Chain 'D':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvd_
  • Chain 'E':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgve_
  • Chain 'F':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvf_
  • Chain 'G':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvg_
  • Chain 'H':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvh_
  • Chain 'I':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvi_
  • Chain 'J':
    Compound: Hydrogenase-1 operon protein hyaE
    Species: Shigella flexneri 2a [TaxId:198214]
    Gene: hyaE, SF0977, S_1044
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83RW6
      • modified residue (13)
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.04: d2qgvj_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qgvA (A:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvA (A:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qgvB (B:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvB (B:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qgvC (C:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvC (C:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qgvD (D:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvD (D:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qgvE (E:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvE (E:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qgvF (F:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvF (F:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2qgvG (G:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvG (G:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2qgvH (H:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvH (H:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2qgvI (I:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvI (I:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2qgvJ (J:)
    msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
    llhefpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlm
    rglvepqqeraslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qgvJ (J:)
    tpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhe
    fpdytwqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglv
    e