PDB entry 2qgg
View 2qgg on RCSB PDB site
Description: X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248. Northeast Structural Genomics Consortium target AsR73.
Class: structural genomics, unknown function
Keywords: NESG, AsR73, Acinetobacter calcoaceticus, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on
2007-06-28, released
2007-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-01-24, with a file datestamp of
2018-01-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 16S rRNA-processing protein rimM
Species: Acinetobacter calcoaceticus [TaxId:471]
Gene: rimM, ACIAD3312
Database cross-references and differences (RAF-indexed):
- Uniprot Q6F7I0
- modified residue (35)
- modified residue (38)
- see remark 999 (45)
- see remark 999 (73)
- see remark 999 (78-79)
- see remark 999 (84-85)
- see remark 999 (87)
- see remark 999 (90)
- see remark 999 (98)
- see remark 999 (118)
- modified residue (140)
- see remark 999 (146)
- see remark 999 (149)
- see remark 999 (151)
- modified residue (155)
Domains in SCOPe 2.08: d2qgga1, d2qgga2 - Heterogens: K, UNL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2qggA (A:)
mtptqnvpedriqigqlrsayglngwlwvysntepmsnmfdylpwyietkagwqtvdvkr
wkphgkglvvslkgvsdrtgaeslvasniwiaksqlpkadvdeyywsdlkgltvlgldde
eqevnlgqihelfetgandvmvvratpdsidseermipwhkdvvqrvdleagriyvnwgv
dy
Sequence, based on observed residues (ATOM records): (download)
>2qggA (A:)
nvpedriqigqlrsayglngwlwvysntepmsnmfdylpwyietkagwqtvdvkrwkphg
kglvvslkgvsdrtgaeslvasniwiaksqlpkadvdeyywsdlkgltvlglddeeqevn
lgqihelfetgandvmvvratpdsidseermipwhkdvvqrvdleagriyvnwgvd