PDB entry 2qgg

View 2qgg on RCSB PDB site
Description: X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248. Northeast Structural Genomics Consortium target AsR73.
Class: structural genomics, unknown function
Keywords: X-Ray, NESG, AsR73, Acinetobacter calcoaceticus, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2007-06-28, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S rRNA-processing protein rimM
    Species: Acinetobacter calcoaceticus [TaxId:471]
    Gene: rimM, ACIAD3312
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6F7I0
      • modified residue (35)
      • modified residue (38)
      • see remark 999 (45)
      • see remark 999 (73)
      • see remark 999 (78-79)
      • see remark 999 (84-85)
      • see remark 999 (87)
      • see remark 999 (90)
      • see remark 999 (98)
      • see remark 999 (118)
      • modified residue (140)
      • see remark 999 (146)
      • see remark 999 (149)
      • see remark 999 (151)
      • modified residue (155)
    Domains in SCOPe 2.07: d2qgga1, d2qgga2
  • Heterogens: K, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qggA (A:)
    mtptqnvpedriqigqlrsayglngwlwvysntepmsnmfdylpwyietkagwqtvdvkr
    wkphgkglvvslkgvsdrtgaeslvasniwiaksqlpkadvdeyywsdlkgltvlgldde
    eqevnlgqihelfetgandvmvvratpdsidseermipwhkdvvqrvdleagriyvnwgv
    dy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qggA (A:)
    nvpedriqigqlrsayglngwlwvysntepmsnmfdylpwyietkagwqtvdvkrwkphg
    kglvvslkgvsdrtgaeslvasniwiaksqlpkadvdeyywsdlkgltvlglddeeqevn
    lgqihelfetgandvmvvratpdsidseermipwhkdvvqrvdleagriyvnwgvd