PDB entry 2qfr

View 2qfr on RCSB PDB site
Description: Crystal structure of red kidney bean purple acid phosphatase with bound sulfate
Class: hydrolase
Keywords: binuclear metal centre, substrate analog, Hydrolase
Deposited on 2007-06-27, released 2008-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qfra1, d2qfra2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qfrb1, d2qfrb2
  • Heterogens: FE, ZN, SO4, NDG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfrA (A:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfrB (B:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst