PDB entry 2qfd

View 2qfd on RCSB PDB site
Description: Crystal structure of the regulatory domain of human RIG-I with bound Hg
Class: hydrolase
Keywords: Zinc Finger, Alternative splicing, Antiviral defense, ATP-binding, Helicase, Hydrolase, Immune response, Innate immunity, Interferon induction, Nucleotide-binding, Polymorphism, RNA-binding, Ubl conjugation
Deposited on 2007-06-27, released 2008-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.241
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfda_
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdb_
  • Chain 'C':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdc_
  • Chain 'D':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdd_
  • Chain 'E':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfde_
  • Chain 'F':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdf_
  • Chain 'G':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdg_
  • Chain 'H':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdh_
  • Chain 'I':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdi_
  • Chain 'J':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qfdj_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qfdA (A:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdA (A:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qfdB (B:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdB (B:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qfdC (C:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdC (C:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qfdD (D:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdD (D:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qfdE (E:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdE (E:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qfdF (F:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdF (F:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2qfdG (G:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdG (G:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2qfdH (H:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdH (H:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2qfdI (I:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdI (I:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2qfdJ (J:)
    mgsshhhhhhssglvprgshmdkenkkllcrkckalacytadvrvieechytvlgdafke
    cfvsrphpkpkqfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatg
    vqtlyskwkdfhfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qfdJ (J:)
    kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
    fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
    m