PDB entry 2qel

View 2qel on RCSB PDB site
Description: Crystal structure of the highly amyloidogenic transthyretin mutant TTR G53S/E54D/L55S- heated protein
Class: transport protein
Keywords: Greek key, Beta barrel, Beta-slip, Protein heating, TRANSPORT PROTEIN
Deposited on 2007-06-26, released 2007-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.234
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d2qela_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d2qelb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d2qelc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d2qeld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qelA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qelA (A:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qelB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qelB (B:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qelC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qelC (C:)
    lmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiykv
    eidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qelD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qelD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp