PDB entry 2qe7

View 2qe7 on RCSB PDB site
Description: Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
Class: hydrolase
Keywords: blockage of ATP hydrolysis, F1-ATPase, ATP synthase, single particle analysis, thermoalkaliphilic, HYDROLASE
Deposited on 2007-06-25, released 2007-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: 0.252
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qe7a1, d2qe7a2, d2qe7a3
  • Chain 'B':
    Compound: ATP synthase subunit alpha
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qe7b1, d2qe7b2, d2qe7b3
  • Chain 'C':
    Compound: ATP synthase subunit alpha
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qe7c1, d2qe7c2, d2qe7c3
  • Chain 'D':
    Compound: ATP synthase subunit beta
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qe7d1, d2qe7d2, d2qe7d3
  • Chain 'E':
    Compound: ATP synthase subunit beta
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qe7e1, d2qe7e2, d2qe7e3
  • Chain 'F':
    Compound: ATP synthase subunit beta
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qe7f1, d2qe7f2, d2qe7f3
  • Chain 'G':
    Compound: ATP synthase subunit gamma
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qe7g_
  • Chain 'H':
    Compound: ATP synthase subunit epsilon
    Species: Bacillus sp. [TaxId:90973]
    Gene: atpC
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qe7A (A:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe7A (A:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qe7B (B:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe7B (B:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qe7C (C:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe7C (C:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qe7D (D:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe7D (D:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qe7E (E:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe7E (E:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qe7F (F:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe7F (F:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2qe7G (G:)
    mqgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagt
    kdfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgr
    kgrdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspiv
    qrpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefga
    rmtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe7G (G:)
    gmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkishpmlearpvkkt
    gymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrkgrdffkkrgypvvee
    vtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivqrpvekqllpltsllp
    kyaetliysalldakasefgarmtamgnatdnatemletltlqfnra
    

  • Chain 'H':
    No sequence available.