PDB entry 2qdy

View 2qdy on RCSB PDB site
Description: Crystal Structure of Fe-type NHase from Rhodococcus erythropolis AJ270
Class: lyase
Keywords: nitrile hydratase, post translation, LYASE
Deposited on 2007-06-22, released 2008-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qdya_
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qdyb_
  • Heterogens: FE, CL, MG, GOL, IBN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qdyA (A:)
    msvtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qdyA (A:)
    enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qdyB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qdyB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepa