PDB entry 2qdt

View 2qdt on RCSB PDB site
Description: Structural Basis for the Broad-Spectrum Inhibition of Metallo-{Beta}-Lactamases: L1- IS38 Complex
Class: hydrolase
Keywords: hydrolase, zn, metallo, lactamase, inhibitor, l1
Deposited on 2007-06-21, released 2007-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase L1
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qdta_
  • Heterogens: ZN, SO4, I38, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qdtA (A:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qdtA (A:)
    evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
    hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
    lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
    yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
    kaltckayadaaeqkfdgqlaketag