PDB entry 2qdn

View 2qdn on RCSB PDB site
Description: Crystal Structure of mouse GITRL
Class: immune system
Keywords: GITRL; Glucocorticoid-Induced TNF Receptor Ligand, IMMUNE SYSTEM
Deposited on 2007-06-21, released 2008-01-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qdna1
  • Chain 'B':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qdnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qdnA (A:)
    gshmptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkk
    yikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntyw
    giilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qdnA (A:)
    scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
    vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
    fis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qdnB (B:)
    gshmptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkk
    yikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntyw
    giilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qdnB (B:)
    scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
    vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
    fis