PDB entry 2qdi

View 2qdi on RCSB PDB site
Description: Drosophila OBP LUSH D118A mutation
Class: transport protein
Keywords: Odorant binding protein, OBP, pheromone binding protein, PBP, TRANSPORT PROTEIN
Deposited on 2007-06-20, released 2008-06-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General odorant-binding protein lush
  Species: Drosophila melanogaster
  Gene: lush, Obp76a, Obp76c
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (0-123)
    • engineered (117)
  Domains in SCOPe 2.02: d2qdia_
• Chain 'B':
  Compound: General odorant-binding protein lush
  Species: Drosophila melanogaster
  Gene: lush, Obp76a, Obp76c
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (0-123)
    • engineered (117)
  Domains in SCOPe 2.02: d2qdib_
• Heterogens: PGE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qdiA (A:)
  mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
  kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenaagq
  fmwp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qdiB (B:)
  mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
  kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenaagq
  fmwp