PDB entry 2qd9

View 2qd9 on RCSB PDB site
Description: P38 Alpha Map Kinase inhibitor based on heterobicyclic scaffolds
Class: transferase
Keywords: serine/threonine-protein kinase, kinase, transferase, p38 map kinase
Deposited on 2007-06-20, released 2007-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.252
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qd9a_
  • Heterogens: LGF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qd9A (A:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qd9A (A:)
    rptfyrqelnktiwevperyqnlspvgaygsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarwyrapeimlnwmhynq
    tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
    tqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadp
    ydqsfesrdllidewksltydevisfvppp