PDB entry 2qd2

View 2qd2 on RCSB PDB site
Description: F110A variant of human ferrochelatase with protoheme bound
Class: biosynthetic protein
Keywords: Heme synthesis, Ferrochelatase, Protoporphyrin IX, Heme biosynthesis, Iron, Lyase, Porphyrin biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2007-06-20, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp686P18130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZA3 (0-358)
      • engineered (45)
    Domains in SCOPe 2.07: d2qd2a_
  • Chain 'B':
    Compound: Ferrochelatase
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp686P18130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZA3 (0-358)
      • engineered (45)
    Domains in SCOPe 2.07: d2qd2b_
  • Heterogens: BCT, FES, IMD, CHD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qd2A (A:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapaiakrrtpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qd2B (B:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapaiakrrtpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql