PDB entry 2qcq

View 2qcq on RCSB PDB site
Description: Crystal structure of Bone Morphogenetic Protein-3 (BMP-3)
Class: signaling protein
Keywords: BMP, TGF-beta, SIGNALING PROTEIN
Deposited on 2007-06-19, released 2007-10-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.23
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2qcqa_
  • Chain 'B':
    Compound: Bone morphogenetic protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2qcqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qcqA (A:)
    qwieprncarrylkvdfadigwsewiispksfdayycsgacqfpmpkslkpsnhatiqsi
    vravgvvpgipepccvpekmsslsilffdenknvvlkvypnmtvescacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qcqA (A:)
    eprncarrylkvdfadigwsewiispksfdayycsgacqfpmpkslkpsnhatiqsivra
    vgvvpgipepccvpekmsslsilffdenknvvlkvypnmtvescacr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qcqB (B:)
    qwieprncarrylkvdfadigwsewiispksfdayycsgacqfpmpkslkpsnhatiqsi
    vravgvvpgipepccvpekmsslsilffdenknvvlkvypnmtvescacr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qcqB (B:)
    ieprncarrylkvdfadigwsewiispksfdayycsgacqfpmpkslkpsnhatiqsivr
    avgvvpgipepccvpekmsslsilffdenknvvlkvypnmtvescacr