PDB entry 2qcb

View 2qcb on RCSB PDB site
Description: T7-tagged full-length streptavidin complexed with ruthenium ligand
Class: biotin binding protein
Keywords: streptavidin, t7-tag, artificial transfer hydrogenase, BIOTIN BINDING PROTEIN
Deposited on 2007-06-19, released 2008-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • t7-tag (12)
      • engineered (111)
    Domains in SCOPe 2.07: d2qcba2, d2qcba3
  • Heterogens: KYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qcbA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltkgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qcbA (A:)
    deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltkgtteanawkstlvghdtftk
    vk