PDB entry 2qca

View 2qca on RCSB PDB site
Description: A New Crystal Form of Bovine Pancreatic RNase A in Complex with 2'-Deoxyguanosine-5'-monophosphate
Class: hydrolase
Keywords: Ribonuclease, Protein-Nucleotide Complex, Structural Genomics, PSI-2, Protein Structure Initiative, Center for High-Throughput Structural Biology, CHTSB, HYDROLASE
Deposited on 2007-06-19, released 2007-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.125
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qcaa_
  • Heterogens: DGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qcaA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv