PDB entry 2qc9

View 2qc9 on RCSB PDB site
Description: Mouse Notch 1 Ankyrin Repeat Intracellular Domain
Class: transcription
Keywords: beta-hydroxy asparagine, ankyrin repeat, factor inhibiting HIF, TRANSCRIPTION
Deposited on 2007-06-19, released 2008-03-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.173
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Notch 1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: Notch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qc9a_
  • Chain 'B':
    Compound: Notch 1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: Notch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qc9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qc9A (A:)
    gsvisdfiyqgaslhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplh
    aavsadaqgvfqillrnratdldarmhdgttplilaarlalegmledlinshadvnavdd
    lgksalhwaaavnnvdaavvllkngankdmqnnkeetplflaaregsyetakvlldhfan
    rditdhmdrlprdiaqermhhdivrlldey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qc9A (A:)
    tdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqillrn
    ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
    avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
    rmhhdivrlldey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qc9B (B:)
    gsvisdfiyqgaslhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplh
    aavsadaqgvfqillrnratdldarmhdgttplilaarlalegmledlinshadvnavdd
    lgksalhwaaavnnvdaavvllkngankdmqnnkeetplflaaregsyetakvlldhfan
    rditdhmdrlprdiaqermhhdivrlldey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qc9B (B:)
    lhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqi
    llrnratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavn
    nvdaavvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprd
    iaqermhhdivrlldey