PDB entry 2qbm

View 2qbm on RCSB PDB site
Description: Crystal structure of the P450cam G248T mutant in the cyanide bound state
Class: oxidoreductase
Keywords: CYP101, mutant, conserved active site residue, cyanide complex, Gly248, heme geometry, OXIDOREDUCTASE
Deposited on 2007-06-18, released 2007-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered (248)
    Domains in SCOPe 2.05: d2qbma_
  • Heterogens: CYN, K, HEM, CAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qbmA (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcn
    gghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvtgldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qbmA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvtg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav