PDB entry 2qb3

View 2qb3 on RCSB PDB site
Description: Structural Studies Reveal the Inactivation of E. coli L-Aspartate Aminotransferase by (s)-4,5-dihydro-2-thiophenecarboxylic acid (SADTA) via Two Mechanisms (at pH 7.5)
Class: transferase
Keywords: mechanism-based inactivator, pH dependence, aspartate aminotransferase, SADTA, PLP, TRANSFERASE
Deposited on 2007-06-15, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.144
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: aspC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qb3a_
  • Heterogens: SO4, PSZ, PMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qb3A (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qb3A (A:)
    mfenitaapadlfgkinlgigvykdetgktpvltsvkkaeqyllenettknylgidgipe
    fgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsvkrvwvsnpswpnh
    ksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgcchnptgidptleq
    wqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkelivassysknfglyne
    rvgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsndalraiweqeltd
    mrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlrlreefgvyavasg
    rvnvagmtpdnmaplceaivavl