PDB entry 2qak
View 2qak on RCSB PDB site
Description: HIV-1 PR mutant in complex with nelfinavir
Class: hydrolase
Keywords: HIV protease inhibitors; protease-inhibitor structure; isothermal calorimetry; antiviral resistance development, HYDROLASE
Deposited on
2007-06-16, released
2008-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: human immunodeficiency virus 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (29)
- engineered (54)
- engineered (89)
Domains in SCOPe 2.01: d2qaka_ - Chain 'B':
Compound: protease retropepsin
Species: human immunodeficiency virus 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (29)
- engineered (54)
- engineered (89)
Domains in SCOPe 2.01: d2qakb_ - Heterogens: 1UN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2qakA (A:)
pqitlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfiavrqyd
qilieicghkaigtvlvgptpvniigrnlmtqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2qakB (B:)
pqitlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfiavrqyd
qilieicghkaigtvlvgptpvniigrnlmtqigctlnf