PDB entry 2qa3

View 2qa3 on RCSB PDB site
Description: Structural Studies Reveal the Inactivation of E. coli L-aspartate aminotransferase by (S)-4,5-amino-dihydro-2-thiophenecarboxylic acid (SADTA) via two mechanisms (at pH6.5)
Class: Transferase
Keywords: PLP, SADTA, asparate aminotransferase, mechanism-based inhibitor, E. coli, Transferase
Deposited on 2007-06-14, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.157
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: aspC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qa3a_
  • Heterogens: SO4, PSZ, PMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qa3A (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qa3A (A:)
    mfenitaapaadlfradinlgigvykdetgktpvltsvkkaeqyllenettknylgidgi
    pefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsvkrvwvsnpswp
    nhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgcchnptgidptl
    eqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkelivassysknfgly
    nervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsndalraiweqel
    tdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlrlreefgvyava
    sgrvnvagmtpdnmaplceaivavl