PDB entry 2qa0

View 2qa0 on RCSB PDB site
Description: Structure of Adeno-Associated virus serotype 8
Class: virus
Keywords: beta-barrel, icosahedral virus
Deposited on 2007-06-14, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.255
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Adeno-associated virus - 8 [TaxId:202813]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qa0a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qa0A (A:)
    dgvgsssgnwhcdstwlgdrvittstrtwalptynnhlykqisngtsggatndntyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlsfklfniqvkevtqnegtktiannl
    tstiqvftdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqftytfedvpfhssyahsqsldrlmnplidqylyylsrtqttggtan
    tqtlgfsqggpntmanqaknwlpgpcyrqqrvstttgqnnnsnfawtagtkyhlngrnsl
    anpgiamathkddeerffpsngilifgkqnaardnadysdvmltseeeikttnpvateey
    givadnlqqqntapqigtvnsqgalpgmvwqnrdvylqgpiwakiphtdgnfhpsplmgg
    fglkhpppqilikntpvpadppttfnqsklnsfitqystgqvsveiewelqkenskrwnp
    eiqytsnyykstsvdfavntegvyseprpigtryltrnl