PDB entry 2q9x

View 2q9x on RCSB PDB site
Description: Crystal structure of highly stable mutant Q40P/S47I/H93G of human fibroblast growth factor-1
Class: hormone
Keywords: FGF-1, growth factor, beta trefoil, enhanced stability, HORMONE
Deposited on 2007-06-14, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: HOMO SAPIENS
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (39)
      • engineered (46)
      • engineered (92)
    Domains in SCOPe 2.07: d2q9xa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q9xA (A:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdphiqlqliaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q9xA (A:)
    pkllycsngghflrilpdgtvdgtrdrsdphiqlqliaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleengyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv