PDB entry 2q9p

View 2q9p on RCSB PDB site
Description: Human diphosphoinositol polyphosphate phosphohydrolase 1, Mg-F complex
Class: hydrolase
Keywords: diphosphoinositol polyphosphate phosphohydrolase, nudix, inositol pyrophosphate metabolism, structural genomics consortium, sgc
Deposited on 2007-06-13, released 2007-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.194
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diphosphoinositol polyphosphate phosphohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT3, DIPP, DIPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q9pa_
  • Heterogens: MG, CL, F, IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q9pA (A:)
    mhhhhhhssgvdlgtenlyfqsmmklksnqtrtydgdgykkraaclcfrseseeevllvs
    ssrhpdrwivpgggmepeeepsvaavrevceeagvkgtlgrlvgifenqerkhrtyvyvl
    ivtevledwedsvnigrkrewfkiedaikvlqyhkpvqasyfetlrqgysanngtpvvat
    tysvsaqssmsgir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q9pA (A:)
    rtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrevce
    eagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaikvl
    qyhkpvqasyfe