PDB entry 2q9o

View 2q9o on RCSB PDB site
Description: Near-atomic resolution structure of a Melanocarpus albomyces laccase
Class: Oxidoreductase
Keywords: laccase, multicopper oxidase, Melanocarpus albomyces, 2-oxohistidine, Oxidoreductase
Deposited on 2007-06-13, released 2008-03-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.167
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Laccase-1
    Species: Melanocarpus albomyces [TaxId:204285]
    Gene: LAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70KY3 (0-558)
      • modified residue (97)
    Domains in SCOPe 2.01: d2q9oa1, d2q9oa2, d2q9oa3
  • Chain 'B':
    Compound: Laccase-1
    Species: Melanocarpus albomyces [TaxId:204285]
    Gene: LAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70KY3 (0-558)
      • modified residue (97)
    Domains in SCOPe 2.01: d2q9ob1, d2q9ob2, d2q9ob3
  • Heterogens: NAG, MAN, CU, CL, SO4, OXY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q9oA (A:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q9oB (B:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl