PDB entry 2q9j

View 2q9j on RCSB PDB site
Description: Crystal structure of the C217S mutant of diaminopimelate epimerase
Class: isomerase
Keywords: C217S mutant, two domains, open conformation of the apo-enzyme, Isomerase
Deposited on 2007-06-12, released 2007-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: DAPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44859 (0-273)
      • modified residue (72)
      • engineered (216)
    Domains in SCOPe 2.08: d2q9ja1, d2q9ja2
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q9jA (A:)
    mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
    rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
    piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
    sherfpervnagfmqiinkehiklrvyergagetqasgsgacaavavgimqgllnnnvqv
    dlpggslmiewngvghplymtgeathiydgfitl