PDB entry 2q9h

View 2q9h on RCSB PDB site
Description: Crystal structure of the C73S mutant of diaminopimelate epimerase
Class: Isomerase
Keywords: C73S mutant,two structurally equivalent domains, apo form has an open conformation, Isomerase
Deposited on 2007-06-12, released 2007-10-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: DAPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44859 (0-273)
      • engineered (72)
    Domains in SCOPe 2.05: d2q9ha1, d2q9ha2
  • Heterogens: TLA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2q9hA (A:)
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqsgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
sherfpervnagfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqv
dlpggslmiewngvghplymtgeathiydgfitl