PDB entry 2q93

View 2q93 on RCSB PDB site
Description: E. coli methionine aminopeptidase Mn-form with inhibitor B21
Class: hydrolase
Keywords: aminopeptidase, hydrolase, dinuclear, Mn(II)-form, enzyme-inhibitor complex, metalloenzyme
Deposited on 2007-06-12, released 2008-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.226
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q93a_
  • Heterogens: MN, NA, B21, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2q93A (A:)
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde