PDB entry 2q91

View 2q91 on RCSB PDB site
Description: Structure of the Ca2+-Bound Activated Form of the S100A4 Metastasis Factor
Class: metal binding protein
Keywords: S100A4, myosin, calcium, metastatic tumors, EF-hand, METAL BINDING PROTEIN
Deposited on 2007-06-12, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S100A4 Metastasis Factor
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q91a_
  • Chain 'B':
    Compound: S100A4 Metastasis Factor
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q91b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q91A (A:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q91A (A:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q91B (B:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q91B (B:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkq