PDB entry 2q8o

View 2q8o on RCSB PDB site
Description: crystal structure of mouse GITR ligand dimer
Class: unknown function
Keywords: TNF, GITR, Dimer, UNKNOWN FUNCTION
Deposited on 2007-06-11, released 2007-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q8oa1
  • Chain 'B':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q8ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q8oA (A:)
    drwgsslkptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvip
    vdkkyikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqkn
    ntywgiilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q8oA (A:)
    iescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnap
    fvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqknntywgiilmpd
    lpfis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q8oB (B:)
    drwgsslkptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvip
    vdkkyikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqkn
    ntywgiilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q8oB (B:)
    iescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnap
    fvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqknntywgiilmpd
    lpfis