PDB entry 2q87

View 2q87 on RCSB PDB site
Description: The Crystal Structure of the Human IRp60 Ectodomain
Class: immune system
Keywords: All-beta, immunoglobulin, IG-SUPERFAMILY, IG-V, NKP44-LIKE, Natural killer Cell IG-LIKE RECEPTOR, inhibitory receptor, myelo-monocytic cells, negative regulation of leukocyte, negative regulation of natural killer cells, negative regulation of natural mast cells, membrane protein, irp60, cmrf35, irem, ncr, IMMUNE SYSTEM
Deposited on 2007-06-09, released 2007-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CMRF35-H antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD300A, CMRF35H
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN4 (0-106)
      • engineered (2)
      • conflict (92)
    Domains in SCOPe 2.07: d2q87a_
  • Chain 'B':
    Compound: CMRF35-H antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD300A, CMRF35H
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN4 (Start-106)
      • conflict (92)
      • cloning artifact (107-109)
    Domains in SCOPe 2.07: d2q87b1, d2q87b2
  • Chain 'C':
    Compound: CMRF35-H antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD300A, CMRF35H
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN4 (Start-106)
      • conflict (92)
      • cloning artifact (107-108)
    Domains in SCOPe 2.07: d2q87c1, d2q87c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q87A (A:)
    skartvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsir
    dspanlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvfpas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q87A (A:)
    skartvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsir
    dspanlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q87B (B:)
    skartvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsir
    dspanlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvfpas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q87B (B:)
    rtvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsirdsp
    anlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvfpas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q87C (C:)
    skartvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsir
    dspanlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvfpas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q87C (C:)
    rtvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsirdsp
    anlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvfpa