PDB entry 2q7w

View 2q7w on RCSB PDB site
Description: Structural Studies Reveals the Inactivation of E. coli L-aspartate aminotransferase (S)-4,5-amino-dihydro-2-thiophenecarboxylic acid (SADTA) via two mechanisms at pH 6.0
Class: transferase
Keywords: mechanism-based inhibitor, PLP, SADTA, pH dependence, TRANSFERASE
Deposited on 2007-06-07, released 2007-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.156
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: aspC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-395)
      • modified residue (245)
    Domains in SCOPe 2.07: d2q7wa_
  • Heterogens: SO4, PSZ, PMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q7wA (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7wA (A:)
    mfenitaapakinlgigvykdetgktpvltsvkkaeqyllenettknylgidgipefgrc
    tqellfgkgsalindkrartaqtpggtgalrvaadflakntsvkrvwvsnpswpnhksvf
    nsaglevreyayydaenhtldfdalinslneaqagdvvlfhgcchnptgidptleqwqtl
    aqlsvekgwlplfdfayqgfargleedaeglrafaamhkelivassysknfglynervga
    ctlvaadsetvdrafsqmkaairanysnppahgasvvatilsndalraiweqeltdmrqr
    iqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlrlreefgvyavasgrvnv
    agmtpdnmaplceaivavl