PDB entry 2q7s

View 2q7s on RCSB PDB site
Description: Crystal structure of N-formylglutamate amidohydrolase (YP_297560.1) from Ralstonia eutropha JMP134 at 2.00 A resolution
Class: hydrolase
Keywords: YP_297560.1, N-formylglutamate amidohydrolase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, HYDROLASE
Deposited on 2007-06-07, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-formylglutamate amidohydrolase
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_297560.1, Reut_A3358
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46VW8 (Start-289)
      • modified residue (86)
      • modified residue (173)
      • modified residue (256)
    Domains in SCOPe 2.08: d2q7sa1
  • Chain 'B':
    Compound: N-formylglutamate amidohydrolase
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_297560.1, Reut_A3358
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46VW8 (Start-289)
      • modified residue (86)
      • modified residue (173)
      • modified residue (256)
    Domains in SCOPe 2.08: d2q7sb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q7sA (A:)
    gmnqamdtkqiapftlalpegealplvcdsphsgtfypadfgavvaperlrggedthvda
    lweavprvggtllaatfprvyidpnrmlddidpaqlegpwptplapgektrlgygliwsn
    vdaatpiydrkltvaevqrrinryyrpyhaalteavegayqrfgavwhlnlhsmpnnaye
    rlkiqsprpladfvlgdrdgttcepglvdlverelrekgytvarndpykgvqliaqigrp
    aerrnslqieirrplymeegtrernegfatlqrdltlltlriaeyvrrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7sA (A:)
    iapftlalpegealplvcdsphsgtfypadfgavvaperlrggedthvdalweavprvgg
    tllaatfprvyidpnrmlddidpaqlegpwptplapgtgliwsnvdapiydrkltvaevq
    rrinryyrpyhaalteavegayqrfgavwhlnlhsmpnnayerlkiqsprpladfvlgdr
    dgttcepglvdlverelrekgytvarndpykgqliaqigrpaerrnslqieirrplymee
    gtrernegfatlqrdltlltlriaeyvrrgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q7sB (B:)
    gmnqamdtkqiapftlalpegealplvcdsphsgtfypadfgavvaperlrggedthvda
    lweavprvggtllaatfprvyidpnrmlddidpaqlegpwptplapgektrlgygliwsn
    vdaatpiydrkltvaevqrrinryyrpyhaalteavegayqrfgavwhlnlhsmpnnaye
    rlkiqsprpladfvlgdrdgttcepglvdlverelrekgytvarndpykgvqliaqigrp
    aerrnslqieirrplymeegtrernegfatlqrdltlltlriaeyvrrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7sB (B:)
    iapftlalpegealplvcdsphsgtfypadfgavvaperlrggedthvdalweavprvgg
    tllaatfprvyidpnrmlddidpaqlegpwptplapgektrlgygliwsnvdaatpiydr
    kltvaevqrrinryyrpyhaalteavegayqrfgavwhlnlhsmpnnayerlkiqsprpl
    adfvlgdrdgttcepglvdlverelrekgytvarndpykgvqliaqigrpaerrnslqie
    irrplymeegtrernegfatlqrdltlltlriaeyvrrgv