PDB entry 2q7m

View 2q7m on RCSB PDB site
Description: Crystal structure of human FLAP with MK-591
Class: membrane protein, lipid transport
Keywords: MAPEG, membrane protein, FLAP, LIPID TRANSPORT
Deposited on 2007-06-07, released 2007-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 4.25 Å
R-factor: 0.244
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arachidonate 5-lipoxygenase-activating protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ALOX5AP, FLAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q7ma1
  • Chain 'B':
    Compound: Arachidonate 5-lipoxygenase-activating protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ALOX5AP, FLAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20292 (0-End)
      • engineered (147)
    Domains in SCOPe 2.08: d2q7mb1
  • Chain 'C':
    Compound: Arachidonate 5-lipoxygenase-activating protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ALOX5AP, FLAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20292 (0-End)
      • engineered (147)
    Domains in SCOPe 2.08: d2q7mc1
  • Chain 'D':
    Compound: Arachidonate 5-lipoxygenase-activating protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ALOX5AP, FLAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q7md1
  • Chain 'E':
    Compound: Arachidonate 5-lipoxygenase-activating protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ALOX5AP, FLAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q7me1
  • Chain 'F':
    Compound: Arachidonate 5-lipoxygenase-activating protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ALOX5AP, FLAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20292 (0-End)
      • engineered (147)
    Domains in SCOPe 2.08: d2q7mf1
  • Heterogens: 2CS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q7mA (A:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiatisttisplllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7mA (A:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q7mB (B:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiatisttisplllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7mB (B:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q7mC (C:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiatisttisplllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7mC (C:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q7mD (D:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiatisttisplllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7mD (D:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2q7mE (E:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiatisttisplllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7mE (E:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2q7mF (F:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiatisttisplllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7mF (F:)
    mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
    vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
    flflmsvagifnyylifffgsdfenyiat