PDB entry 2q7f

View 2q7f on RCSB PDB site
Description: Crystal structure of YrrB: a TPR protein with an unusual peptide-binding site
Class: protein binding
Keywords: tpr, yrrb, protein binding
Deposited on 2007-06-06, released 2007-08-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.211
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YrrB protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yrrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2q7fa1
  • Chain 'B':
    Compound: YrrB protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yrrB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q7fA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefgdyekaaeaftkaieenkedaipy
    infanllssvneleralafydkaleldssaatayygagnvyvvkemykeakdmfekalra
    gmengdlfymlgtvlvkleqpklalpylqravelnendtearfqfgmclanegmldeals
    qfaavteqdpghadafynagvtyaykenrekalemldkaidiqpdhmlalhakkllghhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q7fA (A:)
    aaeaftkaieenkedaipyinfanllssvneleralafydkaleldssaatayygagnvy
    vvkemykeakdmfekalragmengdlfymlgtvlvkleqpklalpylqravelnendtea
    rfqfgmclanegmldealsqfaavteqdpghadafynagvtyaykenrekalemldkaid
    iqpdhmlalhakkl
    

  • Chain 'B':
    No sequence available.