PDB entry 2q79

View 2q79 on RCSB PDB site
Description: Crystal Structure of single chain E2C from HPV16 with a 12aa linker for monomerization.
Class: DNA binding protein
Keywords: Beta barrel, DNA BINDING PROTEIN
Deposited on 2007-06-06, released 2007-10-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.227
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q79a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2q79A (A:)
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsigggtgggsgggs

    Sequence, based on observed residues (ATOM records): (download) 
    >2q79A (A:)
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtksaivtltydsewqrdqflsqv
kipktitvstgfms